PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00017625_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 184aa    MW: 20917.3 Da    PI: 6.5223
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00017625_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.51.1e-5437132297
                             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfed 78 
                                       +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+d
  FANhyb_icon00017625_a.1.g00001.1  37 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALSTLGFDD 113
                                       89*************************************************************************** PP

                             NF-YB  79 yveplkvylkkyrelegek 97 
                                       y eplk yl+++relegek
  FANhyb_icon00017625_a.1.g00001.1 114 YSEPLKRYLHRFRELEGEK 132
                                       *****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-5432148IPR009072Histone-fold
SuperFamilySSF471132.02E-4039144IPR009072Histone-fold
PfamPF008088.2E-2842106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-197088No hitNo description
PROSITE patternPS0068507389IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-1989107No hitNo description
PRINTSPR006151.9E-19108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MVDNRGNNSN SIISSDSREG FNYNFSGDRD HHDDMIKEQD RLLPIANVGR IMKQILPPNA  60
KISKEAKETM QECVSEFISF VTGEASDKCH KEKRKTVNGD DICWALSTLG FDDYSEPLKR  120
YLHRFRELEG EKAQQSKANS GGEDQRNEVM EVSPTRASTT SSSTPLMKFN MMNERGNSSI  180
PRRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4436127192Transcription factor HapC (Eurofung)
4g91_B2e-4436127192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309676.11e-120PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822486e-62NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM5VPK95e-85M5VPK9_PRUPE; Uncharacterized protein
STRINGVIT_07s0104g01640.t011e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-62nuclear factor Y, subunit B5